Windy City Times

The Hidden Risk of Air Fryers: How Heat Accumulation Can Cause Long-Term Worktop Damage

Mar 15, 2026 Lifestyle

The air fryer has become a staple in modern kitchens, revolutionizing how people approach cooking. However, experts warn that improper use could lead to unintended damage to worktops over time. According to kitchen specialists, the appliance's heat output—though not as intense as traditional cookware—can still cause gradual wear on surfaces if left unaddressed.

The Hidden Risk of Air Fryers: How Heat Accumulation Can Cause Long-Term Worktop Damage

Simon Roberts of Vogue Worktops highlights that users often overlook the long-term effects of placing air fryers in a fixed position for extended periods. 'While the base may feel cool to the touch, heat accumulates beneath the appliance during operation,' he explains. 'Repeated exposure can cause materials like laminate or wood to degrade, even if the changes are initially subtle.' This slow process often goes unnoticed until visible damage appears.

With nearly two-thirds of UK households owning an air fryer, the risk of localized heat damage is significant. Roberts notes that laminate surfaces are particularly vulnerable to bubbling or lifting due to prolonged warmth. Wooden worktops may also develop discolored patches as their natural oils evaporate from repeated exposure. Even durable engineered materials can succumb to thermal stress when subjected to continuous heat in one area.

The design of air fryers exacerbates this issue, as models often vent hot air from the back or underside. This heat transfer can lead to dulling or fading on nearby surfaces over time, especially if appliances remain stationary for months or years. Roberts advises using protective barriers like heatproof mats or trivets to create a thermal buffer between the appliance and worktop.

To mitigate long-term damage, he recommends periodically repositioning air fryers rather than anchoring them in one spot. 'Even slight adjustments can prevent localized heat buildup,' he says. This simple precaution helps distribute warmth more evenly across worktops, reducing the risk of material degradation.

The Hidden Risk of Air Fryers: How Heat Accumulation Can Cause Long-Term Worktop Damage

Recent research from the University of Birmingham further underscores the importance of proper appliance maintenance. A study found that air fryers produce significantly fewer particulate matter (PM) and volatile organic chemicals (VOCs) compared to shallow or deep-fat frying methods. However, the findings include a critical caveat: if air fryers are not cleaned thoroughly, their environmental benefits diminish.

Professor Christian Pfrang, lead author of the study, emphasizes that residue accumulation in hard-to-reach cooking areas can compromise indoor air quality over time. 'While emissions from air fryers remain well below harmful thresholds, regular deep cleaning is essential to maintain their long-term advantages,' he explains. This insight highlights a growing need for appliance designs that facilitate more effective sanitation.

The Hidden Risk of Air Fryers: How Heat Accumulation Can Cause Long-Term Worktop Damage

As air fryer usage continues to rise globally, balancing convenience with maintenance becomes increasingly important. By addressing both surface protection and cleanliness, users can ensure these appliances remain both functional and safe in the kitchen.

air fryerappliancesdamageheatkitchenworktops